Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENOX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17977820UL
Description
ENOX2 Polyclonal specifically detects ENOX2 in Human samples. It is validated for Western Blot.Specifications
| ENOX2 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_006366 | |
| ENOX2 | |
| Synthetic peptide directed towards the N terminal of human ENOX2The immunogen for this antibody is ENOX2. (YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE). Peptide sequence YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE. | |
| Affinity Purified | |
| RUO | |
| 10495 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| COVA1, Cytosolic ovarian carcinoma antigen 1APK1 antigen, ecto-NOX disulfide-thiol exchanger 2, tNOXAPK1, Tumor-associated hydroquinone oxidase | |
| Rabbit | |
| 66 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction