Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENOX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$159.00 - $487.50
Specifications
| Antigen | ENOX2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17977820
|
Novus Biologicals
NBP17977820UL |
20 μL |
Each for $159.00
|
|
|||||
|
NBP179778
|
Novus Biologicals
NBP179778 |
100 μL |
Each for $487.50
|
|
|||||
Description
ENOX2 Polyclonal specifically detects ENOX2 in Human samples. It is validated for Western Blot.Specifications
| ENOX2 | |
| Polyclonal | |
| Rabbit | |
| NP_006366 | |
| 10495 | |
| Synthetic peptide directed towards the N terminal of human ENOX2The immunogen for this antibody is ENOX2. (YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE). Peptide sequence YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| COVA1, Cytosolic ovarian carcinoma antigen 1APK1 antigen, ecto-NOX disulfide-thiol exchanger 2, tNOXAPK1, Tumor-associated hydroquinone oxidase | |
| ENOX2 | |
| IgG | |
| 66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title