Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENPP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23894525UL
Description
ENPP-1 Polyclonal specifically detects ENPP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ENPP-1 | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
P22413 | |
ENPP1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC | |
25 μL | |
Lipid and Metabolism | |
5167 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ectonucleotide pyrophosphatase/phosphodiesterase 1, E-NPP 1, Ly-41 antigen, M6S1NPP1, Membrane component chromosome 6 surface marker 1, membrane component, chromosome 6, surface marker 1, NPPSalkaline phosphodiesterase 1, PC1, PC-1, PCA1ARHR2, PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, plasma-cell membrane glycoprotein 1, Plasma-cell membrane glycoprotein PC-1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction