ENPP-3/CD203c Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188928

Catalog No. NBP188928

Description

ENPP-3/CD203c Polyclonal specifically detects ENPP-3/CD203c in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ENPP-3/CD203c
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CD203c, CD203c antigen, dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), ectonucleotide pyrophosphatase/phosphodiesterase 3, ectonucleotide pyrophosphatase/phosphodiesterase family member 3, E-NPP 3, gp130RB13-6, NPP3, PD-IBETA, PDNP3B10, Phosphodiesterase I beta, Phosphodiesterase I/nucleotide pyrophosphatase 3, phosphodiesterase-I beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ENPP3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
• Quantity: 0.1 mL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 5169
• Target Species: Human
• Isotype: IgG

For Research Use Only