Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ENTPD8 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen ENTPD8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159484
SDP
View Documents
Novus Biologicals
NBP159484
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

ENTPD8 Polyclonal specifically detects ENTPD8 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ENTPD8
Polyclonal
Rabbit
Q5MY95
377841
Synthetic peptides corresponding to ENTPD8(ectonucleoside triphosphate diphosphohydrolase 8) The peptide sequence was selected from the N terminal of ENTPD8. Peptide sequence IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG.
Primary
Western Blot
Unconjugated
RUO
EC 3.6.1, EC 3.6.1.5, ecto-ATP-diphosphohydrolase, ectonucleoside triphosphate diphosphohydrolase 8, E-NTPDase 8, GLSR2492, liver ecto-ATP-diphosphohydrolase, NTPDase 8, NTPDase8, NTPDase-8, nucleoside triphosphate diphosphohydrolase-8, UNQ2492
ENTPD8
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.