Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EPB41 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | EPB41 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
EPB41 Polyclonal specifically detects EPB41 in Human samples. It is validated for Western Blot.Specifications
EPB41 | |
Polyclonal | |
Rabbit | |
Q4VB86 | |
2035 | |
Synthetic peptides corresponding to EPB41(erythrocyte membrane protein band 4.1) The peptide sequence was selected from the N terminal of EPB41. Peptide sequence SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
4.1RBand 4.1, E41P, EL1, EPB4.1, erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked), erythrocyte surface protein band 4.1, HE, P4.1, protein 4.1 | |
EPB41 | |
IgG | |
85 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title