Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EPB4IL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | EPB4IL2 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
EPB4IL2 Polyclonal specifically detects EPB4IL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
EPB4IL2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
band 4.1-like protein 2,4.1G, DKFZp781D1972, DKFZp781H1755,4.1-G, erythrocyte membrane protein band 4.1 like-protein 2, erythrocyte membrane protein band 4.1-like 2, Generally expressed protein 4.1 | |
EPB41L2 | |
IgG |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Polyclonal | |
Rabbit | |
O43491 | |
2037 | |
Synthetic peptides corresponding to EPB41L2(erythrocyte membrane protein band 4.1-like 2) The peptide sequence was selected from the middle region of EPB41L2. Peptide sequence AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title