Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EpCAM/TROP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP256894 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256894 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP256894 Supplier Novus Biologicals Supplier No. NBP256894

Rabbit Polyclonal Antibody

EpCAM/TROP1 Polyclonal specifically detects EpCAM/TROP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen EpCAM/TROP1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
Gene Symbols EPCAM
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQN
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cancer Stem Cells, Tumor Biomarkers
Primary or Secondary Primary
Gene ID (Entrez) 4072
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.