EpCAM/TROP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256894

Catalog No. NBP256894

Description

EpCAM/TROP1 Polyclonal specifically detects EpCAM/TROP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: EpCAM/TROP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EPCAM
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQN
• Quantity: 100 μL
• Research Discipline: Cancer, Cancer Stem Cells, Tumor Biomarkers
• Gene ID (Entrez): 4072
• Target Species: Human
• Isotype: IgG

For Research Use Only