Invitrogen™ EphB1 Polyclonal Antibody

Catalog No.	Quantity
PIPA595283	100 μg

Catalog No. PIPA595283 Supplier Invitrogen™ Supplier No. PA595283

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human U251 whole cell, human Hel whole cell, rat testis tissue, rat brain tissue, mouse testis tissue, mouse brain tissue. IHC: Human Glioma tissue. Flow: U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

EPHB1 is a receptor tyrosine kinase that belongs to the ephrin receptor family. Members of the Eph family of kinases play important roles in diverse biological processes including nervous system development, angiogenesis and neural synapsis formation and maturation. EphB1 and other ephB family members are type 1 membrane spanning proteins, comprised of immunoglobulin, fibronectin type III, and cysteine rich subdomains in the ecto domain, and the single uninterrupted cytoplasmic tyrosine kinase domain upstream of a carboxyterminal sterile alpha motif (SAM) domain. ephB family proteins bind ephrins of the B class, ligands that are also transmembrane spanning proteins capable of transmitting signals. ephB1 is expressed predominantly in developing neural structures in embryos, and in vascular epithelium of kidney, and other tissues. Upon binding to alternatively oligomerized ephrin B1, ephB1 signals regulation of cell attachment and cellcell assembly. Members of this protein family are implicated in neuronal and vascular cell targeting.

Specifications

• Antigen: EphB1
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: EPHB1
• Gene Accession No.: P09759, P54762, Q8CBF3
• Gene Alias: 9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2
• Gene Symbols: EPHB1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2047, 24338, 270190
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov