Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EPPIN-WFDC6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317970100UL
This item is not returnable.
View return policy
Description
EPPIN-WFDC6 Polyclonal antibody specifically detects EPPIN-WFDC6 in Human samples. It is validated for Immunohistochemistry (Paraffin)Specifications
EPPIN-WFDC6 | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
EPPIN-WFDC6 Readthrough, SPINLW1-WFDC6, SPINLW1-WFDC6 Fusion Protein, SPINLW1-WFDC6 Readthrough, SPINLW1-WFDC6 Read-Through Transcript, WAP four-disulfide core domain protein 6 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD | |
100 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
100526773 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction