EPRS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB432432	Novus Biologicals NBP18492925UL	25ul
NBP184929	Novus Biologicals NBP184929	0.1 mL

Description

EPRS Polyclonal specifically detects EPRS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EPRS
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2058
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Rat
• Gene Alias: bifunctional aminoacyl-tRNA synthetase, Cell proliferation-inducing gene 32 protein, DKFZp313B047, EARS, EC 6.1.1, EC 6.1.1.15, EC 6.1.1.18, GLNS, GLUPRORS, glutamate tRNA ligase, glutaminyl-tRNA synthetase, glutamyl-prolyl-tRNA synthetase, PARSproliferation-inducing gene 32 protein, proliferation-inducing protein 32, proline tRNA ligase, proline-tRNA ligase, prolyl-tRNA synthetase, QARS, QPRS
• Gene Symbols: EPRS
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only