Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ER alpha/NR3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP18482625UL
Description
ER alpha/NR3A1 Polyclonal specifically detects ER alpha/NR3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ER alpha/NR3A1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:50-1:200 | |
P03372 | |
ESR1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT | |
25ul | |
Angiogenesis, Breast Cancer, Cancer, Cell Biology, Cell Cycle and Replication, Dendritic Cell Markers, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
2099 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ER, ER alpha, Era, ER-alpha, ESRESRA, Estradiol receptor, estrogen receptor, estrogen receptor 1, estrogen receptor alpha, estrogen receptor alpha delta 3*4,56,7*/819-2 isoform, estrogen receptor alpha delta 4 +49 isoform, estrogen receptor alpha delta 4*5,6,7*/654 isoform, NR3A1DKFZp686N23123, Nuclear receptor subfamily 3 group A member 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction