ERG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238555

Catalog No. NBP238555

Description

ERG Polyclonal specifically detects ERG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ERG
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P11308
• Gene Symbols: ERG
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQ
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 2078
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: transcriptional regulator ERG, 10ets-related, erg-3, p55, TMPRSS2-ERG prostate cancer specific, transcriptional regulator ERG, Transforming protein ERG, v-ets erythroblastosis virus E26 oncogene homolog (avian), v-ets erythroblastosis virus E26 oncogene like, v-ets erythroblastosis virus E26 oncogene like (avian)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.