Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ERMAP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | ERMAP |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ERMAP Polyclonal antibody specifically detects ERMAP in Human samples. It is validated for ImmunofluorescenceSpecifications
ERMAP | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Human | |
erythroblast membrane-associated protein, erythroblast membrane-associated protein (RD and SC blood groups), erythroblast membrane-associated protein (Scianna blood group), erythroid membrane-associated protein, hERMAP, MGC118810, MGC118811, PRO2801, Radin blood group, Radin blood group (Rd), Radin blood group antigen, RDMGC118812, Scianna blood group, Scianna blood group (Sc), Scianna blood group antigen, SCMGC118813 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
114625 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title