Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ERN2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$289.37 - $684.18
Specifications
| Antigen | ERN2 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ERN2 Polyclonal antibody specifically detects ERN2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ERN2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.7.11, endoplasmic reticulum to nucleus signaling 2, endoplasmic reticulum to nucleus signalling 2, Endoplasmic reticulum-to-nucleus signaling 2, ER to nucleus signalling 2, hIRE2p, inositol-requiring 1 beta, Inositol-requiring protein 2, IRE1, S. cerevisiae, homolog of, Ire1-beta, IRE1bIRE1 beta, IRE2, serine/threonine-protein kinase/endoribonuclease IRE2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 10595 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title