ERP27 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18839325UL

Catalog No. NB431344

Description

ERP27 Polyclonal specifically detects ERP27 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ERP27
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: C12orf46, chromosome 12 open reading frame 46, endoplasmic reticulum protein 27, endoplasmic reticulum protein 27 kDa, endoplasmic reticulum resident protein 27, ER protein 27, ERp27, FLJ32115, PDIA8, protein disulfide isomerase family A, member 8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 121506
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ERP27
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only