Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ERp57/PDIA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications
$416.50 - $682.00
Specifications
Antigen | ERp57/PDIA3 |
---|---|
Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, KnockDown Validated |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ERp57/PDIA3 Polyclonal specifically detects ERp57/PDIA3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
ERp57/PDIA3 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
Disulfide isomerase ER-60, EC 5.3.4.1, endoplasmic reticulum P58, Endoplasmic reticulum resident protein 57, Endoplasmic reticulum resident protein 60, ER protein 60, ER60, ERP57, ERp5758 kDa glucose-regulated protein, ERP60, ERp6058 kDa microsomal protein, ERp61, glucose regulated protein, 58kDa, GRP57, GRP58ER protein 57, HsT17083, P58, phospholipase C-alpha, PI-PLC, protein disulfide isomerase family A, member 3, protein disulfide isomerase-associated 3, protein disulfide-isomerase A3 | |
PDIA3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, KnockDown Validated | |
Polyclonal | |
Rabbit | |
Cellular Markers, ER Markers, Membrane Trafficking and Chaperones | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2923 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title