ERR alpha/NR3B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25681225UL

Catalog No. NB403607

Description

ERR alpha/NR3B1 Polyclonal specifically detects ERR alpha/NR3B1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ERR alpha/NR3B1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ERR1Estrogen receptor-like 1, ERRa, ESRL1ERR-alpha, estrogen-related receptor alphaERRalpha, NR3B1Nuclear receptor subfamily 3 group B member 1, steroid hormone receptor ERR1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ESRRA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG
• Quantity: 25 μL
• Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators
• Gene ID (Entrez): 2101
• Target Species: Human
• Form: Purified

For Research Use Only