Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV2/ER71 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ETV2/ER71 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ETV2/ER71 Polyclonal specifically detects ETV2/ER71 in Mouse samples. It is validated for Western Blot.Specifications
ETV2/ER71 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Mouse | |
ER71MGC129835, ETS translocation variant 2, ets variant 2, Ets-related protein 71, ETSRP71ets variant gene 2, MGC129834 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse ETV2/ER71 (NP_031985). Peptide sequence GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
2116 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title