Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ETV3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159712 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159712 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. NB159712 Supplier Novus Biologicals Supplier No. NBP317841100UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ETV3 Polyclonal antibody specifically detects ETV3 in Human samples. It is validated for Western Blot

Specifications

Antigen ETV3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias bA110J1.4, ETS domain transcriptional repressor PE1, ETS translocation variant 3, ets variant 3, ets variant gene 3, ETS family transcriptional repressor, METS, Mitogenic Ets transcriptional suppressor, PE-1ets variant gene 3, PE1FLJ79173
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2117
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.