Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$573.00
Specifications
| Antigen | ETV3 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ETV3 Polyclonal antibody specifically detects ETV3 in Human samples. It is validated for Western BlotSpecifications
| ETV3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| bA110J1.4, ETS domain transcriptional repressor PE1, ETS translocation variant 3, ets variant 3, ets variant gene 3, ETS family transcriptional repressor, METS, Mitogenic Ets transcriptional suppressor, PE-1ets variant gene 3, PE1FLJ79173 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 2117 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title