Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV3L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ETV3L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ETV3L Polyclonal specifically detects ETV3L in Human samples. It is validated for Western Blot.Specifications
ETV3L | |
Polyclonal | |
Rabbit | |
NP_001004341 | |
440695 | |
Synthetic peptide directed towards the C terminal of human ETV3LThe immunogen for this antibody is ETV3L. Peptide sequence LPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERLW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ets variant 3-like, ets variant gene 3-like | |
ETV3L | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title