Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ETV3L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ETV3L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179215
|
Novus Biologicals
NBP179215 |
100 μL |
Each of 1 for $436.00
|
|
Description
ETV3L Polyclonal specifically detects ETV3L in Human samples. It is validated for Western Blot.Specifications
ETV3L | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ets variant 3-like, ets variant gene 3-like | |
ETV3L | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_001004341 | |
440695 | |
Synthetic peptide directed towards the C terminal of human ETV3LThe immunogen for this antibody is ETV3L. Peptide sequence LPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERLW. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title