Invitrogen™ ETV4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579223

Catalog No. PIPA579223

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Lung Tissue, HELA whole cell, A549 whole cell, SW620 whole cell.

ETV4: ets variant gene 4 (E1A enhancer binding protein, E1AF), also known as PEA3. Several members of the Ets gene family are known to encode sequencespecific DNA binding proteins. These include mouse PU. 1, mouse and human Ets-1, Drosophila E74, chicken and human Ets-2 and rat GABP-a. Each of these proteins recognizes similar motifs in DNA that share a centrally located 5'-GGAA-3' element. For instance, PEA3 binds the motif 5'-AGGAAG-3' (the PEA-3 motif), but does not bind to the sequence 5'-AGGAAC-3', recognized by PU. 1, although PU. 1 binds equally well to both sequences. It appears that all of the Ets proteins recognize the same central core sequence but that each protein interacts with unique sequences that flank this core. PEA3 is expressed at readily detectable levels in cells of epithelial and fibroblastic origin but is not expressed in hematopoietic cells. This is in contrast to other members of the Ets gene family, such as Ets-1, Ets-2 and Fli-1, each of which is expressed primarily in cells of hematopoietic origin.

Specifications

• Antigen: ETV4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ETV4
• Gene Alias: Adenovirus E1A enhancer-binding protein; AW414408; E1A F; E1AF; E1A-F; ETS translocation variant 4; ets variant 4; ets variant gene 4 (E1A enhancer binding protein, E1AF); ets variant gene 4 (E1A enhancer-binding protein, E1AF); ETS variant protein 4; Etv4; EWS protein/E1A enhancer binding protein chimera; PEA3; Pea-3; PEA3 protein; PEAS3; Polyomavirus enhancer activator 3; POLYOMAVIRUS ENHANCER ACTIVATOR 3 (PEA3 PROTEIN) (ETS TRANSLOCATION VARIANT 4); polyomavirus enhancer activator 3 homolog; polyomavirus enhancer activator-3; Protein PEA3
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2118, 360635
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P43268
• Gene Symbols: ETV4
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG