Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Evx1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1797020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1797020 20 μL
NBP179701 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1797020 Supplier Novus Biologicals Supplier No. NBP17970120UL

Rabbit Polyclonal Antibody

Evx1 Polyclonal specifically detects Evx1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Evx1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001980
Gene Alias eve, even-skipped homeo box homolog 1, eve, even-skipped homeobox homolog 1, eve, even-skipped homeobox homolog 1 (Drosophila), even-skipped homeo box 1 (homolog of Drosophila), even-skipped homeobox 1, EVX-1, homeobox even-skipped homolog protein 1
Gene Symbols EVX1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human EVX1The immunogen for this antibody is EVX1. Peptide sequence PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ.
Molecular Weight of Antigen 42 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2128
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.