Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Evx1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Evx1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1797020
|
Novus Biologicals
NBP17970120UL |
20 μL |
Each for $152.22
|
|
NBP179701
|
Novus Biologicals
NBP179701 |
100 μL |
Each for $436.00
|
|
Description
Evx1 Polyclonal specifically detects Evx1 in Human samples. It is validated for Western Blot.Specifications
Evx1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
eve, even-skipped homeo box homolog 1, eve, even-skipped homeobox homolog 1, eve, even-skipped homeobox homolog 1 (Drosophila), even-skipped homeo box 1 (homolog of Drosophila), even-skipped homeobox 1, EVX-1, homeobox even-skipped homolog protein 1 | |
EVX1 | |
IgG | |
Affinity Purified | |
42 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001980 | |
2128 | |
Synthetic peptide directed towards the N terminal of human EVX1The immunogen for this antibody is EVX1. Peptide sequence PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title