Invitrogen™ EWSR1 Monoclonal Antibody (4B4)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549161

Catalog No. PIMA549161

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence different from the related mouse sequence by one amino acid. Positive Control - WB: K562 whole cell, Jurkat whole cell, A549 whole cell, MCF-7 whole cell, COLO-320 whole cell, SW620 whole cell, A431 whole cell. IHC: human placenta tissue, mouse spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a ttranslocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Specifications

• Antigen: EWSR1
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q01844, Q61545
• Gene Symbols: EWSR1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Monkey
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Clone: 4B4
• Conjugate: Unconjugated
• Gene: EWSR1
• Gene Alias: AC002059.7; bK984G1.4; Ewing sarcoma breakpoint region 1; Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma homolog; Ewings sarcoma EWS-Fli1 (type 1) oncogene; Ews; EWS oncogene; EWS RNA binding protein 1; EWS RNA-binding protein 1; EWS RNA-binding protein variant 6; EWS-FLI1; Ewsh; EWSR1; RNA-binding protein EWS
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14030, 2130
• Content And Storage: -20°C
• Form: Lyophilized