Invitrogen™ EWSR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579225

Catalog No. PIPA579225

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human K562 whole cell, human Jurkat whole cell, human HL-60 whole cell, human HEK293 whole cell. IHC: Mouse Testis tissue, Rat Testis tissue, Human Mammary Cancer tissue IHC-F: mouse intestine tissue, rat intestine tissue, human placenta tissue. ICC/IF: U20S cell, human SMMC-7721 cell. Flow: U20S cell.

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a ttranslocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Specifications

• Antigen: EWSR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: EWSR1
• Gene Alias: AC002059.7; bK984G1.4; Ewing sarcoma breakpoint region 1; Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma homolog; Ewings sarcoma EWS-Fli1 (type 1) oncogene; Ews; EWS oncogene; EWS RNA binding protein 1; EWS RNA-binding protein 1; EWS RNA-binding protein variant 6; EWS-FLI1; Ewsh; EWSR1; RNA-binding protein EWS
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 14030, 2130, 289752
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q01844, Q61545
• Gene Symbols: EWSR1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG