EXPH5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180506

Catalog No. NBP180506

Description

EXPH5 Polyclonal specifically detects EXPH5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EXPH5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp781H0795, exophilin 5, SLAC2B, synaptotagmin-like homologue lacking C2 domains b
• Host Species: Rabbit
• Molecular Weight of Antigen: 222 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 85%; Equine: 85%; Canine: 78%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_055880
• Gene Symbols: EXPH5
• Immunogen: Synthetic peptide directed towards the middle region of human EXPH5. Peptide sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23086
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only