Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FA2H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | FA2H |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16892820
|
Novus Biologicals
NBP16892820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP168928
|
Novus Biologicals
NBP168928 |
100 μL |
Each for $487.50
|
|
|||||
Description
FA2H Polyclonal specifically detects FA2H in Mouse samples. It is validated for Western Blot.Specifications
| FA2H | |
| Polyclonal | |
| Rabbit | |
| Q5MPP0 | |
| 79152 | |
| Synthetic peptides corresponding to Fa2h (fatty acid 2-hydroxylase) The peptide sequence was selected from the C terminal of Fa2h. Peptide sequence HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FAAHFAXDC1, FAH1, fatty acid 2-hydroxylase, Fatty acid alpha-hydroxylase, fatty acid hydroxylase domain containing 1, FLJ25287, SCS7, spastic paraplegia 35 (autosomal recessive), SPG35 | |
| FA2H | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title