FAAH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169705

Catalog No. NBP169705

Description

FAAH2 Polyclonal specifically detects FAAH2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAAH2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AMDD, amidase domain containing, Amidase domain-containing protein, Anandamide amidohydrolase 2, EC 3.5.1.99, FAAH-2, fatty acid amide hydrolase 2, fatty-acid amide hydrolase 2, FLJ31204, Oleamide hydrolase 2, RP11-479E16.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 158584
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6GMR7
• Gene Symbols: FAAH2
• Immunogen: Synthetic peptides corresponding to FAAH2(fatty acid amide hydrolase 2) The peptide sequence was selected from the C terminal of FAAH2. Peptide sequence SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only