Invitrogen™ FABP2 Polyclonal Antibody

Catalog No.	Quantity
PIPA579230	100 μg

Catalog No. PIPA579230 Supplier Invitrogen™ Supplier No. PA579230

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: SW620 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. ICC/IF: A431 cell.

The FABP2 gene encodes the intestinal fatty acid-binding protein 2 (I-FABP), which plays a significant role in lipid metabolism by facilitating the transport and intracellular trafficking of long-chain fatty acids in enterocytes, the absorptive cells in the intestine. FABP2 is involved in the uptake, metabolism, and transfer of fatty acids across cellular membranes, contributing to digestion and absorption processes in the intestine. This protein is crucial for efficient lipid metabolism, influencing fatty acid oxidation, and energy balance. Variations in the FABP2 gene have been associated with metabolic traits, such as insulin sensitivity, lipid profiles, and obesity, suggesting its impact on metabolic health. FABP2's function in intestinal lipid absorption and metabolism makes it a subject of interest in studies related to dietary effects on health and the development of metabolic disorders. Understanding FABP2's role is essential for insights into nutritional influences on health and possible therapeutic targets for metabolic diseases.

Specifications

• Antigen: FABP2
• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: FABP2
• Gene Accession No.: P02693, P12104, P55050
• Gene Alias: FABP; Fabp2; Fabpi; fatty acid binding protein 1; fatty acid binding protein 2; fatty acid binding protein 2, intestinal; fatty acid-binding protein 2; Fatty acid-binding protein, intestinal; I-FABP; intestinal fatty acid binding protein; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein; MGC133132
• Gene Symbols: FABP2
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 14079, 2169, 25598
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov