Learn More
Abnova™ FABP5 Recombinant Protein
Human FABP5 full-length ORF recombinant protein with GST-tag at N-terminal
Manufacturer: Abnova™ H00002171P0110
Description
This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus.
- Molecular Weight: 40.59kDa
- Preparation Method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer
Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH19385 | |
Solution | |
2171 | |
FABP5 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FABP5 | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
40.59 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE | |
E-FABP/EFABP/PA-FABP/PAFABP | |
FABP5 | |
Wheat Germ (in vitro) | |
GST |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.