Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FACL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169303
Description
FACL4 Polyclonal specifically detects FACL4 in Human samples. It is validated for Western Blot.Specifications
FACL4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ACS4mental retardation, X-linked 68, acyl-CoA synthetase 4, acyl-CoA synthetase long-chain family member 4, EC 6.2.1.3, FACL4long-chain 4, LACS 4, LACS4MRX68, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 4, long-chain fatty-acid-Coenzyme A ligase 4, long-chain-fatty-acid--CoA ligase 4, mental retardation, X-linked 63, MRX63 | |
Rabbit | |
74 kDa | |
100 μL | |
Lipid and Metabolism | |
2182 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O60488 | |
ACSL4 | |
Synthetic peptides corresponding to ACSL4(acyl-CoA synthetase long-chain family member 4) The peptide sequence was selected from the N terminal of ACSL4. Peptide sequence AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction