Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAHD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | FAHD1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAHD1 Polyclonal specifically detects FAHD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FAHD1 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
C16orf36, chromosome 16 open reading frame 36, DKFZP566J2046, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain-containing protein 1, MGC74876, YISK like/RJD15, YISKL, YisK-like protein | |
FAHD1 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
81889 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title