Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FALDH Antibody, Novus Biologicals™
SDP

Catalog No. NBP159679 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159679 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159679 Supplier Novus Biologicals Supplier No. NBP159679
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

FALDH Polyclonal specifically detects FALDH in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen FALDH
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P51648
Gene Alias Aldehyde dehydrogenase 10, aldehyde dehydrogenase 3 family, member A2, Aldehyde dehydrogenase family 3 member A2, ALDH10FLJ20851, EC 1.2.1, EC 1.2.1.3, FALDHDKFZp686E23276, fatty aldehyde dehydrogenase, Microsomal aldehyde dehydrogenase, SLS
Gene Symbols ALDH3A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family, member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 224
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.