FALDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159679

Catalog No. NBP159679

Description

FALDH Polyclonal specifically detects FALDH in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: FALDH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Aldehyde dehydrogenase 10, aldehyde dehydrogenase 3 family, member A2, Aldehyde dehydrogenase family 3 member A2, ALDH10FLJ20851, EC 1.2.1, EC 1.2.1.3, FALDHDKFZp686E23276, fatty aldehyde dehydrogenase, Microsomal aldehyde dehydrogenase, SLS
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 224
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: P51648
• Gene Symbols: ALDH3A2
• Immunogen: Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family, member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.