Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FALDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	FALDH
Applications	Western Blot, Immunohistochemistry
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159679 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159679	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FALDH Polyclonal specifically detects FALDH in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen	FALDH
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene Alias	Aldehyde dehydrogenase 10, aldehyde dehydrogenase 3 family, member A2, Aldehyde dehydrogenase family 3 member A2, ALDH10FLJ20851, EC 1.2.1, EC 1.2.1.3, FALDHDKFZp686E23276, fatty aldehyde dehydrogenase, Microsomal aldehyde dehydrogenase, SLS
Gene Symbols	ALDH3A2
Isotype	IgG
Molecular Weight of Antigen	58 kDa

Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P51648
Gene ID (Entrez)	224
Immunogen	Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family, member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FALDH Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents