Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM105A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | FAM105A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15997920
|
Novus Biologicals
NBP15997920UL |
20 μL |
Each for $152.22
|
|
NBP159979
|
Novus Biologicals
NBP159979 |
100 μL |
Each for $436.00
|
|
Description
FAM105A Polyclonal specifically detects FAM105A in Human samples. It is validated for Western Blot.Specifications
FAM105A | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 105, member A, FLJ11127, FLJ43660, hypothetical protein LOC54491, NET20 | |
FAM105A | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NUU6 | |
54491 | |
Synthetic peptides corresponding to FAM105A(family with sequence similarity 105, member A) The peptide sequence was selected from the middle region of FAM105A. Peptide sequence QYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title