FAM107A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154335

Catalog No. NBP154335

Description

FAM107A Polyclonal specifically detects FAM107A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM107A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: downregulated in renal cell carcinoma, DRR1family with sequence similarity 107 member A transcript, family with sequence similarity 107, member A, FLJ30158, FLJ45473, Protein TU3A, TU3ADown-regulated in renal cell carcinoma 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95990
• Gene Symbols: FAM107A
• Immunogen: Synthetic peptides corresponding to FAM107A(family with sequence similarity 107, member A) The peptide sequence was selected from the middle region of FAM107A. Peptide sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11170
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only