Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM120A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | FAM120A |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM120A Polyclonal specifically detects FAM120A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
FAM120A | |
Polyclonal | |
Rabbit | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
23196 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Unconjugated | |
RUO | |
C9orf10MGC133257, chromosome 9 open reading frame 10, constitutive coactivator of PPAR-gamma-like protein 1, DNA polymerase-transactivated protein 1, DNA polymerase-transactivated protein 5, DNAPTP1, DNAPTP5, family with sequence similarity 120A, KIAA0183MGC111527, OSSA, Oxidative stress-associated Src activator, Protein FAM120A | |
FAM120A | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title