Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM120A Antibody, Novus Biologicals™

FAM120A Antibody, Novus Biologicals™
SDP

Catalog No. NB396678 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396678 25 μL
NBP238771 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396678 Supplier Novus Biologicals Supplier No. NBP23877125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FAM120A Polyclonal specifically detects FAM120A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen FAM120A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9NZB2
Gene Alias C9orf10MGC133257, chromosome 9 open reading frame 10, constitutive coactivator of PPAR-gamma-like protein 1, DNA polymerase-transactivated protein 1, DNA polymerase-transactivated protein 5, DNAPTP1, DNAPTP5, family with sequence similarity 120A, KIAA0183MGC111527, OSSA, Oxidative stress-associated Src activator, Protein FAM120A
Gene Symbols FAM120A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23196
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.