Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM120AOS Antibody, Novus Biologicals™
SDP

Catalog No. p-200042349 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB437855 25ul
NBP214493 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB437855 Supplier Novus Biologicals Supplier No. NBP21449325UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

FAM120AOS Polyclonal specifically detects FAM120AOS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FAM120AOS
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C9orf10OS, FAM120AOS family with sequence similarity 120A opposite strand
Gene Symbols FAM120AOS
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: KSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSP
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 158293
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.