FAM122C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23180525UL

Catalog No. NB437190

Description

FAM122C Polyclonal specifically detects FAM122C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM122C
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q6P4D5
• Gene Symbols: FAM122C
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: family with sequence similarity 122C, hypothetical protein LOC159091, RP3-473B4.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 159091
• Target Species: Human
• Isotype: IgG

For Research Use Only