Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                FAM131B Rabbit anti-Human, Polyclonal, Novus Biologicals™
 
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | FAM131B | 
|---|---|
| Dilution | Western Blot 1.0 ug/ml | 
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
Description
FAM131B Polyclonal specifically detects FAM131B in Human samples. It is validated for Western Blot.Specifications
| FAM131B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| family with sequence similarity 131, member B, KIAA0773hypothetical protein LOC9715 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM131B. Peptide sequence IEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGEKEARFLAGVMEQFAI | |
| Affinity purified | 
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 9715 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            