Novus Biologicals™ FAM132B Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM132B. Source: E.coli Amino Acid Sequence: EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP The FAM132B Recombinant Protein Antigen is derived from E. coli. The FAM132B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 151176
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: FAM132B Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
• Gene Symbol: FAM132B
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.