Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM133B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | FAM133B |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM133B Polyclonal specifically detects FAM133B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FAM133B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| family with sequence similarity 133, member B, hypothetical protein LOC257415, MGC40405 | |
| FAM133B | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 257415 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AMARSRGPIQSSGPTIQDYLNRPRPTWEEV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title