Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM135B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17964320UL
Description
FAM135B Polyclonal specifically detects FAM135B in Human samples. It is validated for Western Blot.Specifications
| FAM135B | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| NP_056996 | |
| FAM135B | |
| Synthetic peptide directed towards the middle region of human FAM135BThe immunogen for this antibody is FAM135B. Peptide sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| family with sequence similarity 135, member B, MGC126009 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51059 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction