Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM153B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM153B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM153B Polyclonal specifically detects FAM153B in Human samples. It is validated for Western Blot.Specifications
FAM153B | |
Polyclonal | |
Rabbit | |
Human | |
202134 | |
Synthetic peptide directed towards the middle region of human LOC202134. Peptide sequence: VKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEE | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp434D115, family with sequence similarity 153, member B | |
FAM153B | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title