Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM167A Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19123625UL

 View more versions of this product

Catalog No. NB405431


Only null left
Add to Cart

Description

Description

FAM167A Polyclonal specifically detects FAM167A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

FAM167A
Polyclonal
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
C8orf13, family with sequence similarity 167, member A, hypothetical protein LOC83648, MGC120649
Rabbit
Affinity Purified
RUO
83648
Human
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
FAM167A
This antibody was developed against Recombinant Protein corresponding to amino acids:GQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMR
25 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only