Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM173B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM173B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM173B Polyclonal specifically detects FAM173B in Human samples. It is validated for Western Blot.Specifications
FAM173B | |
Polyclonal | |
Rabbit | |
Human | |
family with sequence similarity 173, member B, FLJ20667, hypothetical protein LOC134145 | |
FAM173B | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q6P4H8 | |
134145 | |
Synthetic peptides corresponding to LOC134145 The peptide sequence was selected from the N terminal of LOC134145. Peptide sequence EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title