Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM188A Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | FAM188A |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
FAM188A Polyclonal specifically detects FAM188A in Rat samples. It is validated for Western Blot.Specifications
| FAM188A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| C10orf97caspase recruitment domain containing pro-apoptotic protein, CARPRP11-394I23.1, chromosome 10 open reading frame 97, Dermal papilla-derived protein 5, DERP5CARD-containing protein, family with sequence similarity 188, member A, FLJ13397, MST126, my042, Protein CARP | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fam188a (NP_001099592). Peptide sequence CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 80013 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title